PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_D29E210A1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 236aa    MW: 26423.1 Da    PI: 8.2094
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_D29E210A1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.74.3e-32161219159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK+vk+s +prsY+rCt+++C+vkk+ver ++d ++v++tYeg+H+h+
  Traes_6DL_D29E210A1.1 161 LDDGYKWRKYGQKVVKNSLHPRSYFRCTHSNCRVKKRVERLSTDCRMVITTYEGRHTHP 219
                            59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-33146219IPR003657WRKY domain
SuperFamilySSF1182903.53E-28153220IPR003657WRKY domain
PROSITE profilePS5081128.908156219IPR003657WRKY domain
SMARTSM007749.1E-38161220IPR003657WRKY domain
PfamPF031063.8E-25162219IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MHICMDQGSQ LGMAYCLPNL SVPDHYYTTP VPLSPLQLPF HPKPLQMPFD QEEALMLSSD  60
HCGLYPLPAL PFGGGHSAAA PATVCEKPTV GFMPNIEAEE VGTSVTARVG YEGVTACNGY  120
SSNTWWRGST MLAGEKGKMK VRRKMREPRF CFQTRSDVDV LDDGYKWRKY GQKVVKNSLH  180
PRSYFRCTHS NCRVKKRVER LSTDCRMVIT TYEGRHTHPP CDDNSSSSGD NTTTCF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-25152218874Probable WRKY transcription factor 4
2lex_A5e-25152218874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572766.31e-106PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY44e-60WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLW5GZU71e-180W5GZU7_WHEAT; Uncharacterized protein
STRINGMLOC_12078.11e-150(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP113838130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.14e-59WRKY family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]